Schools have free credit (use the order form): Pay 14 days after receiving order. GST receipt provided. No account setup required.

Read More

Product Added to your Cart
x

-------- OR --------

Welcome to come-here.co.nz
$0.00
NZD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPROMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
search

Stop battery theft from calculators

This is a free solution provided with any calculator purchase on request

The same battery cover retention solution works on the following models:
  • Fx9750GII
  • Fx9750GIII
  • Fx9860GII
  • Fx9860GIII
  • Fx9750GA Plus






Compared to using tape, the perfect battery cover retention solution to deter battery theft from calculators would:
  • Not leave tape residue during removal
  • Be covert (i.e. not visible or obvious to defeat)
  • Be a reusable component, so that during battery replacement no special consumable need to be found
  • Require a tool to remove, but a tool that is relatively common
  • Be quick and easy to fit and remove if you know the secret and have the tool
  • Be free (made from a common item just lying around)
The solution above does all that
 
Pete Cross Thursday, 29 February 2024 0 Comments
Leave a reply
Optional, for replies


No comments posted yet, check back soon.
Blogs